Transcript | Ll_transcript_478119 |
---|---|
CDS coordinates | 323-889 (+) |
Peptide sequence | MEALVCRELGDPTVSVEDKSSPTIVSKNHPIPQLNSPTSVRVRVKATSLNFANYLQVMGKYQEKPPLPFIPGSDFSGYVDAVGPKVSNFRVGDPVCSFAALGSFAEFIVVDETQLFQVPEGCDLVAAGALAVASGTSHVALVHRAQLKPGQSAIRIVATNCSVAVFPQLHRDHNSCKHGILVTAIQNR* |
ORF Type | complete |
Blastp | Quinone oxidoreductase-like protein 2 homolog from Nematostella with 41.83% of identity |
---|---|
Blastx | Quinone oxidoreductase-like protein 2 homolog from Nematostella with 39.88% of identity |
Eggnog | alcohol dehydrogenase(COG0604) |
Kegg | Link to kegg annotations (NEMVE_v1g238856) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019417509.1) |
Pfam | Alcohol dehydrogenase GroES-like domain (PF08240.11) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer