Protein coding transcript 101064

• Transcript: Ll_transcript_460892
• CDS coordinates: 1024-1545 (+)
• Peptide sequence: MKHLAENPEAYNQSLRWKYEGPSDSFKALVDMAAVHSSCRLCIHVATKIRENEEKSPGFKKRPCKCTRGSETVYHIYVRERGRFEMESIYLRSSNLTLEALKSAVALKFKSRNHVPIWKPERPEILRGGNDLKIYRIYPLGLTQRQALYSFSFQGDVDFRNHLDSNPCAKFEVI
• ORF Type: 3prime_partial

Annotations of Ll_transcript_460892

• Blastp: Glycoprotein 3-alpha-L-fucosyltransferase A from Arabidopsis with 71.26% of identity
• Blastx: Glycoprotein 3-alpha-L-fucosyltransferase A from Arabidopsis with 70.14% of identity
• Eggnog: (Alpha (1,3) fucosyltransferase(ENOG410ZIMX)
• Kegg: Link to kegg annotations (AT3G19280)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019421409.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;