Protein coding transcript 101067

• Transcript: Ll_transcript_460895
• CDS coordinates: 428-865 (+)
• Peptide sequence: MAAVHSSCRLCIHVATTIRENEEKSPAFKKRPCKCTRGSETVHHIYVRERGRFETESIYLRSSNLTLEALKSAVALKFKSLNHVPIWKPERPEMLRGGNELKIYRIYPAGLTQRQALYSFSFKGDVDFRSHLDINPCAKFEVIFV*
• ORF Type: complete

Annotations of Ll_transcript_460895

• Blastp: Glycoprotein 3-alpha-L-fucosyltransferase A from Arabidopsis with 68.97% of identity
• Blastx: Glycoprotein 3-alpha-L-fucosyltransferase A from Arabidopsis with 70.81% of identity
• Eggnog: (Alpha (1,3) fucosyltransferase(ENOG410ZIMX)
• Kegg: Link to kegg annotations (AT3G19280)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019424262.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;