Transcript | Ll_transcript_461757 |
---|---|
CDS coordinates | 359-712 (+) |
Peptide sequence | MLHPRDVHRPALSHASEIRRNRVASVSSETICSITCTPFPSMAIPLCTCNGGSCPSFQSREVETGDEPSHSSQASALDQNKTEGPRVEKTSCTNMFRARRSCSREHRCDSEINTGTQ* |
ORF Type | complete |
Blastp | Probable E3 ubiquitin-protein ligase XBOS33 from Oryza sativa with 42.98% of identity |
---|---|
Blastx | Probable E3 ubiquitin-protein ligase XBOS33 from Oryza sativa with 47.78% of identity |
Eggnog | Ankyrin Repeat(COG0666) |
Kegg | Link to kegg annotations (9266159) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019464952.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer