Protein coding transcript 101144

• Transcript: Ll_transcript_461763
• CDS coordinates: 3-722 (+)
• Peptide sequence: VNGHVRCLRLVVADFVPSAPYEALYARSDADTTDGSDVKSKGEQSELSKFVNKVAEGGITALHMAALNGHFDCVQLLLDLNANVSTTTIHHGTSIDIIGPGSTPLHYAACGGSLKCCQILLARGASRMIVNCNEWLPLDIARMWGRYWLEPLLAPISDAAIPSFPSSKYLSLPLMSVLNIARSINQSDCIVGPSTCLVGMNNGTCKSQNQAFKGNNCFLTSGAGDKDKVTITFLWMLPI*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_461763

• Blastp: E3 ubiquitin-protein ligase XBAT33 from Arabidopsis with 67.19% of identity
• Blastx: E3 ubiquitin-protein ligase XBAT33 from Arabidopsis with 67.19% of identity
• Eggnog: Ankyrin Repeat(COG0666)
• Kegg: Link to kegg annotations (AT5G07270)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019464952.1)
• Pfam: Ankyrin repeats (many copies) (PF13637.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;