Protein coding transcript 10122

• Transcript: Ll_transcript_478291
• CDS coordinates: 188-577 (+)
• Peptide sequence: MRIMTSYLRVQKPLPFINFKSITRAFSVAATKSPPSKAIIYSTHGEPNAVTKLVSVPGIEVKENEVCVKMLAAPINPSDINRIQGVYPVRPEPPAVGGYEGVGEVYSVGSAVHSFSPGDWVIPSPPSFG*
• ORF Type: complete

Annotations of Ll_transcript_478291

• Blastp: Enoyl-[acyl-carrier-protein] reductase, mitochondrial from Arabidopsis with 68.91% of identity
• Blastx: Enoyl-[acyl-carrier-protein] reductase, mitochondrial from Arabidopsis with 65.38% of identity
• Eggnog: alcohol dehydrogenase(COG0604)
• Kegg: Link to kegg annotations (AT3G45770)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019447916.1)
• Pfam: Alcohol dehydrogenase GroES-like domain (PF08240.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;