Transcript | Ll_transcript_460071 |
---|---|
CDS coordinates | 3-941 (+) |
Peptide sequence | PPMVVVGVVGYIETPHGLRSLATVWAEHLSEDCRRRYYKNWYKSKKKAFTKSSKRWQDELGRKSIEKTFKRMAKYCKFIRVICHTQMKLLRHGQKKAHMLEVQLNGGTVQDKIKWAREHLEKPVPVSNVFSPDEMIDTIAVTKGHGVKGVTSRWHTKKLPRKTHKGLRKVACIGAWHPSRVSFTVARAGQKGYHHRTEMNKKIYRIGQGVHVKDGKVVKNNASTEYDLTEKSITPMGGFPHYGEVNNDFLMVKGCVVGSKKRVITLRKSLIVHSKRVALEKINLKFIDTSSKFGHGRFQTSADKAAFMGPRKK |
ORF Type | internal |
Blastp | 60S ribosomal protein L3 from Sophophora with 78.59% of identity |
---|---|
Blastx | 60S ribosomal protein L3 from Sophophora with 78.59% of identity |
Eggnog | One of the primary rRNA binding proteins, it binds directly near the 3'-end of the 23S rRNA, where it nucleates assembly of the 50S subunit (By similarity)(COG0087) |
Kegg | Link to kegg annotations (Dmel_CG4863) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_020232111.1) |
Pfam | Ribosomal protein L3 (PF00297.21) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer