Protein coding transcript 101256

• Transcript: Ll_transcript_460076
• CDS coordinates: 30-320 (+)
• Peptide sequence: MSHRKFEAPRHGSLAFLPRKRAARHRGKVKSFPKDDPKKPVHLTAAMGYKAGMTTIVRDLDRPGAKLHKKEIVEACTVIETPPMIAVGLVGYIETPR
• ORF Type: 3prime_partial

Annotations of Ll_transcript_460076

• Blastp: 60S ribosomal protein L3 from Aspergillus with 90.72% of identity
• Blastx: 60S ribosomal protein L3 from Aspergillus with 90.72% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (AFUA_2G11850)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_004496455.1)
• Pfam: Ribosomal protein L3 (PF00297.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;