Transcript | Ll_transcript_460076 |
---|---|
CDS coordinates | 30-320 (+) |
Peptide sequence | MSHRKFEAPRHGSLAFLPRKRAARHRGKVKSFPKDDPKKPVHLTAAMGYKAGMTTIVRDLDRPGAKLHKKEIVEACTVIETPPMIAVGLVGYIETPR |
ORF Type | 3prime_partial |
Blastp | 60S ribosomal protein L3 from Aspergillus with 90.72% of identity |
---|---|
Blastx | 60S ribosomal protein L3 from Aspergillus with 90.72% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (AFUA_2G11850) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_004496455.1) |
Pfam | Ribosomal protein L3 (PF00297.21) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer