Protein coding transcript 101281

• Transcript: Ll_transcript_462384
• CDS coordinates: 258-779 (+)
• Peptide sequence: MDGDRKTPDPSDYPIDGAQKVRSLHGRTSGPTRRSTKGQWTSEEDDILRKAVQRFKGKNWKKIAECFNNRTDVQCLHRWQKVLNPELIKGPWSKEEDEVIIELVNKYGPKKWSTIAQHLPGRIGKQCRERWHNHLNPAINKEAWTQEEELALIHAHQIYGNKWAELTKFLPGR*
• ORF Type: complete

Annotations of Ll_transcript_462384

• Blastp: Transcription factor MYB3R-4 from Arabidopsis with 31.68% of identity
• Blastx: Transcription factor MYB3R-4 from Arabidopsis with 31.39% of identity
• Eggnog: Myblike DNAbinding domain containing protein(COG5147)
• Kegg: Link to kegg annotations (AT5G11510)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019447482.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;