Transcript | Ll_transcript_462379 |
---|---|
CDS coordinates | 332-724 (+) |
Peptide sequence | MESDRKVPAQSDGVVQKGRALHGRTTGPTRRSTKGQWTPEEDEILCQAVQRFKGKNWKKIAECFKDRTDVQCLHRWQKVLNPELVKGPWSKEEDEIIISLVNKYGPKKWSNIAQHLPGRIGKQCRERYGL* |
ORF Type | complete |
Blastp | Transcription factor MYB3R-4 from Arabidopsis with 28.36% of identity |
---|---|
Blastx | Transcription factor MYB3R-4 from Arabidopsis with 34.77% of identity |
Eggnog | Myblike DNAbinding domain containing protein(COG5147) |
Kegg | Link to kegg annotations (AT5G11510) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019438403.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer