Protein coding transcript 1013

• Transcript: Ll_transcript_334295
• CDS coordinates: 3-338 (+)
• Peptide sequence: ELEKDVIDSTSQVFPIITVGPVVPVSLLGGDESSDVGIEMWKPEDSCIEWLNHKPDSSVIYISFGSLTVLSSEQKDSIAEALKKIHHPFLWVIKEENKDPLPKEFLEETKDR
• ORF Type: internal

Annotations of Ll_transcript_334295

• Blastp: UDP-glycosyltransferase 84B2 from Arabidopsis with 47.96% of identity
• Blastx: 7-deoxyloganetin glucosyltransferase from Gardenia with 41.53% of identity
• Eggnog: Transferase(COG1819)
• Kegg: Link to kegg annotations (AT2G23250)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019439159.1)
• Pfam: UDP-glucoronosyl and UDP-glucosyl transferase (PF00201.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;