Protein coding transcript 101305

• Transcript: Ll_transcript_460948
• CDS coordinates: 171-1124 (+)
• Peptide sequence: MGSLPSWRKAYGALKDTTKVGLAHVNSDYADLDVAIVKATNHVECPPKERHVRKLMFATSVVRPRADVAYCIHALSRRTAKTRNWTVALKTLIVVHRLLREGDPTFREELLNFSQRGRILQLSNFKDDSSPIAWDCSAWVRTYALFLEERLDCFRILKYDIEAEHLNKPAGGQGKGYSKTRGLDSEKLMEQLPALQQLLNRLVGCQPQGAAGSNHVIQYALALVLKESFKIYCVINDGIINLVDKFFDMPKHEAIIALDVYRRAGQQAESLSDFYEVCKGLELARSFQFPVLKEPPQSFLTTMEEYIREAPRVVTVPS
• ORF Type: 3prime_partial

Annotations of Ll_transcript_460948

• Blastp: Putative clathrin assembly protein At2g01600 from Arabidopsis with 83.33% of identity
• Blastx: Putative clathrin assembly protein At2g01600 from Arabidopsis with 83.33% of identity
• Eggnog: Clathrin assembly protein(ENOG410XQ90)
• Kegg: Link to kegg annotations (AT2G01600)
• CantataDB: Link to cantataDB annotations (CNT0000240)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019464583.1)
• Pfam: ANTH domain (PF07651.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;