Transcript | Ll_transcript_460952 |
---|---|
CDS coordinates | 204-884 (+) |
Peptide sequence | MATLQSWRKAYGALKDTTKVGLAHVNSDYADLDVAIVKATNHVECPPKERHLRKIHFATTAIRPRADVVYCIHSLARRLAKTRNWTVALKTLIVIHRLLREGDPTFREELLNFSQRGRILQLANFKDDSSPIAWDCSAWVRTYAFFLEERLECFRILKYDIEAERLPKSAPGQEKGHSRTRGLDSEELLEQLPALQKLLYRLLGCRPEGAAFSNHVIQYALALVCI* |
ORF Type | complete |
Blastp | Putative clathrin assembly protein At1g14910 from Arabidopsis with 82.59% of identity |
---|---|
Blastx | Putative clathrin assembly protein At2g01600 from Arabidopsis with 87.05% of identity |
Eggnog | Clathrin assembly protein(ENOG410XQ90) |
Kegg | Link to kegg annotations (AT1G14910) |
CantataDB | Link to cantataDB annotations (CNT0000240) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019437441.1) |
Pfam | ANTH domain (PF07651.15) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer