Protein coding transcript 101324

• Transcript: Ll_transcript_460963
• CDS coordinates: 163-615 (+)
• Peptide sequence: MNKLLIESPVQRLGATGAVEVKRHAFFKDINWDTLARQKAMFIPSTEALDTSYFMSRYIWNPEDEHLAGGSDFDNITESTSGSGSDLLLDEDGDECGSLADFSAPALEVQYSFSNFSFKNLSQLASINYDLVIKNSKDSPDNSNPNPSDT*
• ORF Type: complete

Annotations of Ll_transcript_460963

• Blastp: Probable serine/threonine protein kinase IRE from Arabidopsis with 71.52% of identity
• Blastx: Probable serine/threonine protein kinase IRE from Arabidopsis with 68.94% of identity
• Eggnog: microtubule associated serine threonine kinase(ENOG410XPWX)
• Kegg: Link to kegg annotations (AT5G62310)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019413851.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;