Protein coding transcript 101332

• Transcript: Ll_transcript_462117
• CDS coordinates: 4008-4640 (+)
• Peptide sequence: MIISSIWNSSQVLLSVNVLSGEVFCITPTDSNFSWSLLTLDGNNILAVSSSSVDVPQVKYGVLVEKENDNNEWSWSDVSDPIFKCSDEVRSLMSSLKFNVMKIPVKGASVSPTTGAHKPYETIFVSSKAKKSDTCDPLIVILHGGPHSTSLTSFSKSLAFLSALGYSLLIVNYRGSLGFGEEALQSLLGKIGSQVPIGYLCLILEFIMFF*
• ORF Type: complete

Annotations of Ll_transcript_462117

• Blastp: Acylamino-acid-releasing enzyme from Arabidopsis with 64.11% of identity
• Blastx: Acylamino-acid-releasing enzyme 1 from Oryza sativa with 55.83% of identity
• Eggnog: peptidase s9 prolyl oligopeptidase active site domain protein(COG1506)
• Kegg: Link to kegg annotations (AT4G14570)
• CantataDB: Link to cantataDB annotations (CNT0002022)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019449915.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;