Protein coding transcript 101433

• Transcript: Ll_transcript_461227
• CDS coordinates: 1-300 (+)
• Peptide sequence: NSQSNSRRFSSKFNLADDILRQGVRGISDIITVPGLVNVDFADVRAIMANAGSSLMGIGTATGKSRARDAALNAIQSPLLDIGIERATGIVWNITGGSDL
• ORF Type: internal

Annotations of Ll_transcript_461227

• Blastp: Cell division protein FtsZ homolog 2-1, chloroplastic from Arabidopsis with 91.75% of identity
• Blastx: Cell division protein FtsZ homolog 2-1, chloroplastic from Arabidopsis with 91.75% of identity
• Eggnog: Essential cell division protein that forms a contractile ring structure (Z ring) at the future cell division site. The regulation of the ring assembly controls the timing and the location of cell division. One of the functions of the FtsZ ring is to recruit other cell division proteins to the septum to produce a new cell wall between the dividing cells. Binds GTP and shows GTPase activity (By similarity)(COG0206)
• Kegg: Link to kegg annotations (AT2G36250)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_017415288.1)
• Pfam: FtsZ family, C-terminal domain (PF12327.7)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;