Protein coding transcript 101436

• Transcript: Ll_transcript_461232
• CDS coordinates: 72-587 (+)
• Peptide sequence: MKVQSCSRLTILVRSASSQLFQNLDKLYVGNCSGLVNIMTLSVARSFLKLRDLWIYDCERVEEVVACNDDNDIGDVAFIKLEHLQLENLPRLTSFCKENLSFKLPMLKTLYVMECPKMETFSNGILSAPKLEQVLVTPDANGEWLWEGELNATIRKLFDEKEATSSVNHNN*
• ORF Type: complete

Annotations of Ll_transcript_461232

• Blastp: Probable disease resistance protein At1g12280 from Arabidopsis with 32.17% of identity
• Blastx: Cell division protein FtsZ homolog 2-1, chloroplastic from Arabidopsis with 95.71% of identity
• Eggnog: leucine Rich Repeat(COG4886)
• Kegg: Link to kegg annotations (AT1G12280)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019449300.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;