Protein coding transcript 10144

• Transcript: Ll_transcript_478029
• CDS coordinates: 2-355 (+)
• Peptide sequence: ATQSYLLNSLYVTGLQPSILKPTNFGFSQSSKYPTKRKANPSASGAVQCCSCHTEILYAATIQNSLDSDALNTLKLSIPGTLCPSTDFFSGLVLADLDPGTAKLAIGFLGPFLSAFGF
• ORF Type: internal

Annotations of Ll_transcript_478029

• Blastp: Protein COFACTOR ASSEMBLY OF COMPLEX C SUBUNIT B CCB3, chloroplastic from Arabidopsis with 92% of identity
• Blastx: Protein COFACTOR ASSEMBLY OF COMPLEX C SUBUNIT B CCB3, chloroplastic from Arabidopsis with 92% of identity
• Eggnog: integral membrane protein(COG0762)
• Kegg: Link to kegg annotations (AT5G36120)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019449789.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;