Transcript | Ll_transcript_460120 |
---|---|
CDS coordinates | 67-483 (+) |
Peptide sequence | MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNFSWGSEAVTRKTRLLDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGIEIGRKKKSTTSAKKEGEV* |
ORF Type | complete |
Blastp | 40S ribosomal protein S8 from Zea with 89.05% of identity |
---|---|
Blastx | 40S ribosomal protein S8 from Zea with 86.21% of identity |
Eggnog | 40S ribosomal protein S8(COG2007) |
Kegg | Link to kegg annotations (103654822) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_016182244.1) |
Pfam | Ribosomal protein S8e (PF01201.21) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer