Transcript | Ll_transcript_459925 |
---|---|
CDS coordinates | 84-737 (+) |
Peptide sequence | MSRNDSKYFSTTKKGEIPELKEELNSQYKDKRKDAVKKVIAAMTVGKDVSSLFTDVVNCMQTENLELKKLVYLYLINYAKSQPDLAILAVNTFVKDSQDPNPLIRALAVRTMGCIRVDKITEYLCDPLQRCLKDDDPYVRKTAAICVAKLYDINAELVEDRGFLESLKDLISDNNPMVVANAVAALAEIQENSTRPIFEITVPTLTKLLTALNECTE* |
ORF Type | complete |
Blastp | Beta-adaptin-like protein C from Arabidopsis with 95.39% of identity |
---|---|
Blastx | Beta-adaptin-like protein C from Arabidopsis with 95.39% of identity |
Eggnog | The coatomer is a cytosolic protein complex that binds to dilysine motifs and reversibly associates with Golgi non- clathrin-coated vesicles, which further mediate biosynthetic protein transport from the ER, via the Golgi up to the trans Golgi network. Coatomer complex is required for budding from Golgi membranes, and is essential for the retrograde Golgi-to-ER transport of dilysine-tagged proteins(COG5096) |
Kegg | Link to kegg annotations (AT4G23460) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019444618.1) |
Pfam | Adaptin N terminal region (PF01602.19) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer