Protein coding transcript 1015

• Transcript: Ll_transcript_334277
• CDS coordinates: 313-1122 (+)
• Peptide sequence: MGENRKALLVAGLVEIIKEISVLPECHNVCKRMYGNLVRRVKLLSPLFEELRDSDELLSDEQLQAFESLRVALDSAKILLQSVNHGSKLYQALRRNDTVDKFQQVTQKIEEALSEISYNKLEISEEVQEQIELVHAQFKRAKARIEFADLQLDLDIAVMQNEKDPDSSILKRLTEELHLRTMNDLKKESIEIHELIITSNGEAEDVVKAMTSLLRKLKDCVVTENPEVDTSEGRKVSVKHRSPVIPDDFRCPISLELMKDPVIVSTGQV*
• ORF Type: complete

Annotations of Ll_transcript_334277

• Blastp: U-box domain-containing protein 14 from Arabidopsis with 52.11% of identity
• Blastx: U-box domain-containing protein 14 from Arabidopsis with 77.36% of identity
• Eggnog: U-box domain-containing protein(ENOG410XRTN)
• Kegg: Link to kegg annotations (AT3G54850)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019434382.1)
• Pfam: U-box domain (PF04564.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;