Protein coding transcript 101575

• Transcript: Ll_transcript_518122
• CDS coordinates: 89-925 (+)
• Peptide sequence: MEKNLVHILFLYIISFFICVNGKHFVLIHGGSHGAWCWYKVATMLKSANHNVTTFDLAASGINPKQVQEIGSISEYYEPLLKLLESLSQEEKVILVGHSLGGVSMSVAMERFPEKISVAVFVTAYVISENLTYLDLLQELGKSAGSRMDTQFFFFDGPNKPATARLIGPKFMASKMYQLSPPQDLTLALTLVRPVPIYNDVQLLVKETEVSNGRNGKVPKVFIISERDKLITKDIQMWMIGKTGPFAEIKVIKDSDHMVMFSQPRILTTHLIKIGHKY*
• ORF Type: complete

Annotations of Ll_transcript_518122

• Blastp: Salicylic acid-binding protein 2 from Nicotiana with 42.69% of identity
• Blastx: Salicylic acid-binding protein 2 from Nicotiana with 42.69% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (107791137)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019463119.1)
• Pfam: alpha/beta hydrolase fold (PF00561.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;