Protein coding transcript 101642

• Transcript: Ll_transcript_517216
• CDS coordinates: 380-742 (+)
• Peptide sequence: MTGSESPSTFGWNYRNQHVRRDLSRARLRAIENSLENGQAWVPPSSAHRKTWEEEAHIEQALQDHFLFRKLTDSQCHVLLDCMQRVEVEAGDIIVQQGGEGDCFYVVGSGEFEVLATQVQ*
• ORF Type: complete

Annotations of Ll_transcript_517216

• Blastp: Protein phosphatase 2C and cyclic nucleotide-binding/kinase domain-containing protein from Arabidopsis with 84.75% of identity
• Blastx: Protein phosphatase 2C and cyclic nucleotide-binding/kinase domain-containing protein from Arabidopsis with 79.89% of identity
• Eggnog: transcriptional regulator, crp fnr family(COG0664)
• Kegg: Link to kegg annotations (AT2G20050)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019448372.1)
• Pfam: Cyclic nucleotide-binding domain (PF00027.28)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;