Protein coding transcript 101648

• Transcript: Ll_transcript_519567
• CDS coordinates: 447-1034 (+)
• Peptide sequence: MKPKRTKIISDLLISVSKAERQETRMKVRQDSLRLGNVGVIRAGTVISETWEDGQALKDLNAQLRQLIETKEAIERQRKLFKKKQPDKGDGTDAEAGLPEDVLIHDEIYKSRLASIKREEEIILRERDRYELEKGRLIREMKRIRDEDGSRFNNFQILNHRFALLNLLGKGGFSEVYKVRALMKYNIHLIILISF*
• ORF Type: complete

Annotations of Ll_transcript_519567

• Blastp: Serine/threonine-protein kinase TOUSLED from Arabidopsis with 74.59% of identity
• Blastx: Serine/threonine-protein kinase TOUSLED from Arabidopsis with 71.18% of identity
• Eggnog: Tousled-like kinase(ENOG410Y3FX)
• Kegg: Link to kegg annotations (AT5G20930)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019461832.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;