Protein coding transcript 101652

• Transcript: Ll_transcript_519571
• CDS coordinates: 103-684 (+)
• Peptide sequence: MKPKRTKIISDLLISVSKAERQEARLKVRQDSLRLGNIGVIRAGTVISETWEDGQALKDLNAQLRQLIETKEAIERQRKLFKKKQPDKGDGTDAEAGLPEDVLIHDEIYKSRLASIKREEEIILRERDRYELEKGRLIREMKRIRDEDGSRFNNFQILNHRFALLNLLGKGGFSEVYKQAFDLVEHRYVACKLH
• ORF Type: 3prime_partial

Annotations of Ll_transcript_519571

• Blastp: Serine/threonine-protein kinase TOUSLED from Arabidopsis with 77.32% of identity
• Blastx: Serine/threonine-protein kinase TOUSLED from Arabidopsis with 76.7% of identity
• Eggnog: Tousled-like kinase(ENOG410Y3FX)
• Kegg: Link to kegg annotations (AT5G20930)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019461830.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;