Protein coding transcript 101668

• Transcript: Ll_transcript_517768
• CDS coordinates: 288-1127 (+)
• Peptide sequence: MGKRRKDTPGTSVTRSQRNQRNIHSRRQNQVNDTQGSEDNDEDNDNNEKDSSSADERCTESRQSKRKRWTRVRPSQPSSSRASPDGGCIESDMDISRENQGTSRQMTRPRKLTWGRGGFRSHTRYGSGGGSNSKSSRSGRVSKLVDHLRNLDENTDEFEIHLMLISLDKQSTPILQQPHLCCQPTLSIKHLCEYVACQTPLAVEEVEILAVKGCSSAKSDKSVDDTSALICDKLTTMVIDPCKDELEILKEHESLAGITSKCISKMEHLILAYRRKEAL*
• ORF Type: complete

Annotations of Ll_transcript_517768

• Blastp: Putative E3 ubiquitin-protein ligase RING1a from Arabidopsis with 42.37% of identity
• Blastx: Putative E3 ubiquitin-protein ligase RING1a from Arabidopsis with 39.22% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (AT5G44280)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019432179.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;