Protein coding transcript 101670

• Transcript: Ll_transcript_517770
• CDS coordinates: 107-715 (+)
• Peptide sequence: MPGQKRSFSDSLNDGDTSSQFPHHVKQQQQHQQQPKQHEDEDEGNVEHEEEEEQEGDAKEEQNDEDEETGQHQNNNNDEKPQDSDETTSSGPEDKSEFVYVELHEVRKDVQCPICLGIIKKTRTVMECLHRFCRECIDKSMRLGNNECPACRTHCASRRSLRDDPNYDALIAALYPDIEKYEEEELEFREEEKNRNKQVNVS*
• ORF Type: complete

Annotations of Ll_transcript_517770

• Blastp: Putative E3 ubiquitin-protein ligase RING1a from Arabidopsis with 77.19% of identity
• Blastx: Putative E3 ubiquitin-protein ligase RING1a from Arabidopsis with 74.38% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (AT5G44280)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019432121.1)
• Pfam: Zinc finger, C3HC4 type (RING finger) (PF13923.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;