Protein coding transcript 101684

• Transcript: Ll_transcript_519490
• CDS coordinates: 386-1024 (+)
• Peptide sequence: MKLDTSGLESFSTQIVLQSDVVGDISATPSFNLPNSSDFDGFVKEAIQMVKPAKGTTTLAFIFKEGVIVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGTRFSVGSGSPYAYGVLDSGYKYDLSIEEASELARR
• ORF Type: 3prime_partial

Annotations of Ll_transcript_519490

• Blastp: Proteasome subunit beta type-5 from Spinacia with 87.85% of identity
• Blastx: Proteasome subunit beta type-5 from Spinacia with 87.85% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019463074.1)
• Pfam: Proteasome subunit (PF00227.25)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;