Protein coding transcript 101685

• Transcript: Ll_transcript_519491
• CDS coordinates: 1595-1972 (+)
• Peptide sequence: MGLSVGTMIAGWDETGPGLYYVDSEGGRLKGTRFSVGSGSPYAYGVLDSGYKYDLSIEEASELARRAIYHATFRDGASGGVASVYYVGPNGWKKLSGDDVGELHYHYYPVTPSTVEQEMAEAPRV*
• ORF Type: complete

Annotations of Ll_transcript_519491

• Blastp: Proteasome subunit beta type-5-A from Arabidopsis with 89.34% of identity
• Blastx: Proteasome subunit beta type-5-A from Arabidopsis with 90.13% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (AT1G13060)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019463074.1)
• Pfam: Proteasome subunit (PF00227.25)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;