Transcript | Ll_transcript_519477 |
---|---|
CDS coordinates | 440-994 (+) |
Peptide sequence | MKLDTSGLESFSTQIVLQSDVVGDISATPSFNLPNSSDFDGFVKEAIQMVKPAKGTTTLAFIFKEGVIVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGTRFSVGS |
ORF Type | 3prime_partial |
Blastp | Proteasome subunit beta type-5 from Spinacia with 88.17% of identity |
---|---|
Blastx | Proteasome subunit beta type-5 from Spinacia with 88.17% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019463074.1) |
Pfam | Proteasome subunit (PF00227.25) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer