Protein coding transcript 101700

• Transcript: Ll_transcript_519483
• CDS coordinates: 62-733 (+)
• Peptide sequence: MKLDTSGLESFSTQIGFQSDVVGDISAAPSFDLPNSSDFDGFVKEAIQMVKPAKGTTTLAFIFKEGVIVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGTRFSVGSGSPYAYGVLDSGLVKVFCFSIHHLELFCQFSSTFFLYY*
• ORF Type: complete

Annotations of Ll_transcript_519483

• Blastp: Proteasome subunit beta type-5-B from Arabidopsis with 86.43% of identity
• Blastx: Proteasome subunit beta type-5-B from Arabidopsis with 86.43% of identity
• Eggnog: The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity (By similarity)(ENOG410XQRP)
• Kegg: Link to kegg annotations (AT3G26340)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019463074.1)
• Pfam: Proteasome subunit (PF00227.25)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;