Protein coding transcript 101789

• Transcript: Ll_transcript_519253
• CDS coordinates: 88-558 (+)
• Peptide sequence: MASKSFLLHLLLIFLLLVATKISSYDEDLKIEVNYAKPLVAVPPVKPPPPPSPVVKVATPPPVKAPPTNPSPPPPSPPVKAQPPVAPAPLVKSNKECIPLCGYRCKLHSRKQVCLRACVTCCERCKCVPPGTYGNRDKCGKCYTDMLTHGNRPKCP*
• ORF Type: complete

Annotations of Ll_transcript_519253

• Blastp: Gibberellin-regulated protein 14 from Arabidopsis with 66.15% of identity
• Blastx: Gibberellin-regulated protein 14 from Arabidopsis with 70.49% of identity
• Eggnog: Gibberellin regulated protein(ENOG410YXYH)
• Kegg: Link to kegg annotations (AT5G14920)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019442593.1)
• Pfam: Gibberellin regulated protein (PF02704.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;