Transcript | Ll_transcript_519255 |
---|---|
CDS coordinates | 137-550 (+) |
Peptide sequence | MQISSYDEDLKIEVNYAKPLVAVPPVKPPPPPSPVVKVATPPPVKAPPTNPSPPPPSPPVKAQPPVAPAPLVKSNKECIPLCGYRCKLHSRKQVCLRACVTCCERCKCVPPGTYGNRDKCGKCYTDMLTHGNRPKCP* |
ORF Type | complete |
Blastp | Gibberellin-regulated protein 14 from Arabidopsis with 66.15% of identity |
---|---|
Blastx | Gibberellin-regulated protein 14 from Arabidopsis with 70.49% of identity |
Eggnog | Gibberellin regulated protein(ENOG410YXYH) |
Kegg | Link to kegg annotations (AT5G14920) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019442593.1) |
Pfam | Gibberellin regulated protein (PF02704.13) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer