Protein coding transcript 101884

• Transcript: Ll_transcript_517626
• CDS coordinates: 2-796 (+)
• Peptide sequence: KRRFRWRERKDMGFIQRLVIIVIGSLLCLIGTSIGLKHNYGDALKKSILFFEGQRSGKLPQTQRMNWRKDSALQDGSQIDHTLFSASQQVDLVGGYYDAGDNVKFNFPMAFSTTVLAWSVIEFGKSMGPDLKNTLDAIGWATDYFLKVTSVPGFVFVQVGEPYKDHNCWERPEDMDQPRISYAVSKDHPGSEVSAEIAAALAAASIVFRKHHPDYSTRLLQRAREVFDFADKYRGSYSDSLGSTVCPFYCDFGGYQVNPTLLVL*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_517626

• Blastp: Endoglucanase 4 from Arabidopsis with 63.4% of identity
• Blastx: Endoglucanase 4 from Arabidopsis with 63.4% of identity
• Eggnog: Hydrolase, hydrolyzing O-glycosyl compounds(ENOG410YBFA)
• Kegg: Link to kegg annotations (AT1G23210)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019465274.1)
• Pfam: Glycosyl hydrolase family 9 (PF00759.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;