Transcript | Ll_transcript_519029 |
---|---|
CDS coordinates | 2-310 (+) |
Peptide sequence | GGGRSSSTSSWAPTTWVSASGKRIQREMVELNNDPPPYCSAGPKGDNLYHWIATIIATPGTPYQGGIFFLDIIFPTDYPFKPPQVFSATSCILVLFCSILLM* |
ORF Type | 5prime_partial |
Blastp | Constitutive photomorphogenesis protein 10 from Arabidopsis with 68.37% of identity |
---|---|
Blastx | Constitutive photomorphogenesis protein 10 from Arabidopsis with 81.16% of identity |
Eggnog | ubiquitin-conjugating enzyme(COG5078) |
Kegg | Link to kegg annotations (AT3G13550) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019462721.1) |
Pfam | Ubiquitin-conjugating enzyme (PF00179.25) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer