Protein coding transcript 102026

• Transcript: Ll_transcript_517430
• CDS coordinates: 1422-2036 (+)
• Peptide sequence: MMVEGFKMNLIYFDLYQATRLEKFVTAYADFLKANGEQPVTWKRAASMDEVLQEADLISLHPVLDKTTYHLVNKERLSKMKKEAILINCSRGPVVDEVALVEHLRQNPMFRAGLDVFEDEPNMKPGLAELKNAVVVPHIASASKWTREGMATLAALNVLGKIKGYPVWFDANRVEPFLNENVPPPAASPSIVNAKDLGLPVSQV*
• ORF Type: complete

Annotations of Ll_transcript_517430

• Blastp: Glycerate dehydrogenase HPR, peroxisomal from Arabidopsis with 84.31% of identity
• Blastx: Glycerate dehydrogenase HPR, peroxisomal from Arabidopsis with 86.03% of identity
• Eggnog: Dehydrogenase(COG1052)
• Kegg: Link to kegg annotations (AT1G68010)
• CantataDB: Link to cantataDB annotations (CNT0001136)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019428193.1)
• Pfam: D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain (PF02826.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;