Protein coding transcript 102084

• Transcript: Ll_transcript_517297
• CDS coordinates: 127-492 (+)
• Peptide sequence: MFPLFSHEPHFFSHWIIYIKPAIIGLFVQVILLSLSTWLSWFLAGELHAYPKSWIPSSMNSFELALQFGISVMVIACPCALGLATPTAVMVATGVGATQGVLIKGEKALESAHKISELHCI*
• ORF Type: complete

Annotations of Ll_transcript_517297

• Blastp: Probable copper-transporting ATPase HMA5 from Arabidopsis with 83.91% of identity
• Blastx: Copper-transporting ATPase HMA4 from Oryza sativa with 76.39% of identity
• Eggnog: p-type ATPase(COG2217)
• Kegg: Link to kegg annotations (AT1G63440)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_014506120.1)
• Pfam: E1-E2 ATPase (PF00122.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;