Protein coding transcript 102087

• Transcript: Ll_transcript_517281
• CDS coordinates: 3-398 (+)
• Peptide sequence: HLDAGVVPKGFGGPCVLPSTTPLEPLVLLLLKDSTYFFRVILLSLSTWLSWFLAGELHAYPKSWIPSSMNSFELALQFGISVMVIACPCALGLATPTAVMVATGVGATQGVLIKGEKALESAHKISELHCI*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_517281

• Blastp: Probable copper-transporting ATPase HMA5 from Arabidopsis with 83.91% of identity
• Blastx: Probable copper-transporting ATPase HMA5 from Arabidopsis with 79.27% of identity
• Eggnog: p-type ATPase(COG2217)
• Kegg: Link to kegg annotations (AT1G63440)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019420907.1)
• Pfam: E1-E2 ATPase (PF00122.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;