Protein coding transcript 102295

• Transcript: Ll_transcript_518206
• CDS coordinates: 2784-3641 (+)
• Peptide sequence: MEDLDIPWGDLVLKERIGSGSFGTVHRAEWNGSEVAVKILMEQDFYAERSKEFLREVAIMKLLRHPNIVLFMGAVTQPPNLSIVTEYLSRGSLYRLLHRPGAKEMLDKRRRLNMAYDVAKGMNYLHKRNPPIVHRDLKSPNLLVDKKYTVKVCDFGLSRLKANTFLSSKTAAGTPEWMAPEVLRDEPSNEKSDIYSFGVILWELATLQQPWSNLNPAQVVAAVGFKGKRPEIPHDLNPQLASIIESCWTNEPWKRPSFSSIMDSLRVLLKPPTPQPGCPNMPLLA*
• ORF Type: complete

Annotations of Ll_transcript_518206

• Blastp: Serine/threonine-protein kinase CTR1 from Arabidopsis with 59.32% of identity
• Blastx: Serine/threonine-protein kinase CTR1 from Arabidopsis with 83.16% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT5G03730)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019444283.1)
• Pfam: Ethylene-responsive protein kinase Le-CTR1 (PF14381.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;