Protein coding transcript 102300

• Transcript: Ll_transcript_518214
• CDS coordinates: 3-1127 (+)
• Peptide sequence: ISLMGKPESPRVKPAEPTIDFRSLAKQYFSDCLCLELVFDNSSAGAVTDGDSGFPIPDQFDGKYKDRTNARQLTNDSNRSSYLPLHQKVSHSNTHDHDSETTVAKDPPLIKHKRPPAGIRTPLALTNPNNDIIEERLFFEGGQLNPVKPNREIALDMEDLDISWSDLALKERIGSGSFGIVHRAEWNDSEVAVKILMEQDFHAERVNEFLREVAIMKRLRHPNIVLLMGAVTQPPNLSIVTEYLSRGSLYRLLHRPGAKEALDERRRLSMAYDVAKGMNYLHKRNPPIVHRDLKSPNLLVDKKYTVKVGDFGLSRLKANTFLSSKSAAGTPEWMAPEVLRDEPSNEKSDIYSFGVILWELATLQQPWSNLNPAQV
• ORF Type: internal

Annotations of Ll_transcript_518214

• Blastp: Serine/threonine-protein kinase CTR1 from Arabidopsis with 65.85% of identity
• Blastx: Serine/threonine-protein kinase CTR1 from Arabidopsis with 65.85% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT5G03730)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019442966.1)
• Pfam: Protein tyrosine kinase (PF07714.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;