Protein coding transcript 102301

• Transcript: Ll_transcript_518215
• CDS coordinates: 3-1007 (+)
• Peptide sequence: ISLMGKPESPRVKPAEPTIDFRSLAKQYFSDCLCLELVFDNSSAGAVTDGDSGFPIPDQFDGKYKDRTNARQLTNDSNRSSYLPLHQKVSHSNTHDHDSETTVAKDPPLIKHKRPPAGIRTPLALTNPNNDIIEERLFFEGGQLNPVKPNREIALDMEDLDISWSDLALKERIGSGSFGIVHRAEWNDSEVAVKILMEQDFHAERVNEFLREVAIMKRLRHPNIVLLMGAVTQPPNLSIVTEYLSRGSLYRLLHRPGAKEALDERRRLSMAYDVAKGMNYLHKRNPPIVHRDLKSPNLLVDKKYTVKVGDFGLSRLKANTFLSSKSAAGTVSLY*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_518215

• Blastp: Serine/threonine-protein kinase CTR1 from Arabidopsis with 61.68% of identity
• Blastx: Serine/threonine-protein kinase CTR1 from Arabidopsis with 61.68% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT5G03730)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019442966.1)
• Pfam: Protein tyrosine kinase (PF07714.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;