Protein coding transcript 102303

• Transcript: Ll_transcript_518198
• CDS coordinates: 3-899 (+)
• Peptide sequence: EQLEGKHKDRNNPRPIPKDSNISSIIPLHPRAYHPSPHDQGSETFKSCNIVGSTDVIESRRFVEGSQLIPSKPTRDLVLDMEDLDIPWGDLVLKERIGSGSFGTVHRAEWNGSEVAVKILMEQDFYAERSKEFLREVAIMKLLRHPNIVLFMGAVTQPPNLSIVTEYLSRGSLYRLLHRPGAKEMLDKRRRLNMAYDVAKGMNYLHKRNPPIVHRDLKSPNLLVDKKYTVKVCDFGLSRLKANTFLSSKTAAGTPEWMAPEVLRDEPSNEKSDIYSFGVILWELATLQQPWSNLNPAQV
• ORF Type: internal

Annotations of Ll_transcript_518198

• Blastp: Serine/threonine-protein kinase CTR1 from Arabidopsis with 85.9% of identity
• Blastx: Serine/threonine-protein kinase CTR1 from Arabidopsis with 85.9% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT5G03730)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019444282.1)
• Pfam: Protein tyrosine kinase (PF07714.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;