Transcript | Ll_transcript_517161 |
---|---|
CDS coordinates | 142-1410 (+) |
Peptide sequence | MATHDYDDARAVATGPGYDEQLGYDPNFVPDSVKSFVVHLYRHIREKNVYEIHQMYETSFHTLSDRLFKDTPWPSVDAVAHYVDNDHVFCLLYKEMWFRHLYAGLTPTLRQRIDSWDNYCSLFQVVLHGVVNMQLPNQWLWDMVDEFVYQFQSFCQYRAKMKNKTEQEIALLRQFDQAWSVYGVLNFLQALVEKSNIIQILENEKEGLEQFTATDGYDYNGGSNVLKVLGYFGMVGLLRVHCLLGDYHTGLKCLQPIDISQQGVYTLVIGSHITTIYHYGFANLMLRRYVEAIREFNKILLYIYKTKQYHQKSPQYEQILKKNEQMYALLAICLSLCPQSRLVDETVNSQLREKYGEKMIRMQRYDDEAFAIYDELFSYACPKFITPSAPSFEEPLLNYNQVFLAARLFSMHGACNFCSCYLP |
ORF Type | 3prime_partial |
Blastp | Eukaryotic translation initiation factor 3 subunit L from Nematostella with 45.66% of identity |
---|---|
Blastx | Eukaryotic translation initiation factor 3 subunit L from Nematostella with 45.66% of identity |
Eggnog | Component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is involved in protein synthesis and, together with other initiation factors, stimulates binding of mRNA and methionyl-tRNAi to the 40S ribosome (By similarity)(ENOG410XPJT) |
Kegg | Link to kegg annotations (NEMVE_v1g169424) |
CantataDB | Link to cantataDB annotations (CNT0002691) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019415373.1) |
Pfam | RNA polymerase I-associated factor PAF67 (PF10255.8) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer