Protein coding transcript 102377

• Transcript: Ll_transcript_517190
• CDS coordinates: 68-1303 (+)
• Peptide sequence: MASHYEDARAITGGVGYDDHRQQSPQDQLGYDPNFVPDSVKSFVVHLYRHIREKNVYEIHQMYETSFHTLSDRLFKDTPWPSVDAVAHYVDNDHVFCLLYKEMWFRHLYAGLTPTLRQRIDSWDNYCSLFQVVLHGVVNMQLPNQWLWDMVDEFVYQFQSFCQYRAKMKNKTEQEIALLRQFDQAWSVYGVLNFLQALVEKSNIIQILENEKEGLEQFTATDGYDYNGGSNVLKVLGYFGMVGLLRVHCLLGDYHTGLKCLQPIDISQQGVYTLVIGSHITTIYHYGFANLMLRRYVEAIREFNKILLYIYKTKQYHQKSPQYEQILKKNEQMYALLAICLSLCPQSRLVDETVNSQLREKYGEKMIRMQRYDDEAFAIYDELFSYACPKFITPSAPSFEEPLVNYNQVFL*
• ORF Type: complete

Annotations of Ll_transcript_517190

• Blastp: Eukaryotic translation initiation factor 3 subunit L from Nematostella with 45.7% of identity
• Blastx: Eukaryotic translation initiation factor 3 subunit L from Nematostella with 45.7% of identity
• Eggnog: Component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is involved in protein synthesis and, together with other initiation factors, stimulates binding of mRNA and methionyl-tRNAi to the 40S ribosome (By similarity)(ENOG410XPJT)
• Kegg: Link to kegg annotations (NEMVE_v1g169424)
• CantataDB: Link to cantataDB annotations (CNT0002691)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019438410.1)
• Pfam: RNA polymerase I-associated factor PAF67 (PF10255.8)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;