Transcript | Ll_transcript_518188 |
---|---|
CDS coordinates | 645-1061 (+) |
Peptide sequence | MITLGGDAELELVDSLDPFSEGVVFSVRPPKKSWKNIANLSGGEKTLSSLALVFALHHYKPTPLYVMDEIDAALDFKNVSIVGHYVKDRTKDAQFIIISLRNNMFELADRLVGIYKTDNCTKSITINPGSFVVYQKAV* |
ORF Type | complete |
Blastp | Structural maintenance of chromosomes protein 4 from Arabidopsis with 98.53% of identity |
---|---|
Blastx | Structural maintenance of chromosomes protein 4 from Arabidopsis with 98.54% of identity |
Eggnog | Required for chromosome condensation and partitioning (By similarity)(COG1196) |
Kegg | Link to kegg annotations (AT5G48600) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019432441.1) |
Pfam | RecF/RecN/SMC N terminal domain (PF02463.18) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer