Protein coding transcript 102391

• Transcript: Ll_transcript_518189
• CDS coordinates: 316-1191 (+)
• Peptide sequence: MILQVDVDFKLKDMKRALKELEMRGKGYKKRLEELHTAISKHLEQIQVDLVDHEKLQATLSDELLNGACDLKRALEMVTLLEAELKEMNPNLDSIAEYRKKVSLYNERVEELNTVTQERDDIKKHYDELRMKRLDEFMEGFNAISLKLKEMYQMITLGGDAELELVDSLDPFSEGVVFSVRPPKKSWKNIANLSGGEKTLSSLALVFALHHYKPTPLYVMDEIDAALDFKNVSIVGHYVKDRTKDAQFIIISLRNNMFELADRLVGIYKTDNCTKSITINPGSFVVYQKAV*
• ORF Type: complete

Annotations of Ll_transcript_518189

• Blastp: Structural maintenance of chromosomes protein 4 from Arabidopsis with 85.02% of identity
• Blastx: Structural maintenance of chromosomes protein 4 from Arabidopsis with 77.29% of identity
• Eggnog: Required for chromosome condensation and partitioning (By similarity)(COG1196)
• Kegg: Link to kegg annotations (AT5G48600)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019432441.1)
• Pfam: RecF/RecN/SMC N terminal domain (PF02463.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;