Protein coding transcript 102393

• Transcript: Ll_transcript_518192
• CDS coordinates: 1-690 (+)
• Peptide sequence: RISDNFFQHEAACEAFKDAQKQMKSISETIKSKTASISQIKSDIEKSKSEASKAHQVEKDCIIEQDELIPLEQGARQKVAELKSVLDSEKSHGSVLKAILKAKETKQIEGIYGRMGDLGAIDAKYDVAISTACSGLDYIVVETTNAAQACVELLRRENLGVATFMILEKQVDLLPMLKKKVSPPEGVPRLFDLVKVQDERMKLAFFAALRNTVVAKDLDQCCYGGAIHT*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_518192

• Blastp: Structural maintenance of chromosomes protein 4 from Arabidopsis with 68.33% of identity
• Blastx: Structural maintenance of chromosomes protein 4 from Arabidopsis with 68.33% of identity
• Eggnog: Required for chromosome condensation and partitioning (By similarity)(COG1196)
• Kegg: Link to kegg annotations (AT5G48600)
• CantataDB: Link to cantataDB annotations (CNT0001798)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019432441.1)
• Pfam: SMC proteins Flexible Hinge Domain (PF06470.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;