Protein coding transcript 102399

• Transcript: Ll_transcript_517537
• CDS coordinates: 204-1421 (+)
• Peptide sequence: MKVFVKTLKGTHFEIEVNPSDTVSEVKKNIEAVQGADVYPAAQQMLIHQGKVLKDDTTVEENKVAENSFIVIMLSKSKSPSGEGSTATAPSAKAPQTSAVLTPTSVSTAPQAHAVTGTTPLAVTAPTPAPALVPAPASAPVPAPTLSSTAVPGSDVYGQAASNLVAGSNLEETIQLIIDMGGGSWDRDTIVRALRAAYNNPERAVEYLYSGIPEQAEAPPVARVPGSVQPGNSPAAAPQAASVTSSGPNANPLDLFPQGLPNVGAGGAGAGGAGSLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPGEGGGDGGEGNILGQLAGAMPQSVTVTPEEQQAIERLEAMGFDRAIVLEVFFACNKNEELAANYLLDHIHEFDE*
• ORF Type: complete

Annotations of Ll_transcript_517537

• Blastp: Ubiquitin receptor RAD23c from Arabidopsis with 66.67% of identity
• Blastx: Ubiquitin receptor RAD23c from Arabidopsis with 64.71% of identity
• Eggnog: ubiquitin(COG5272)
• Kegg: Link to kegg annotations (AT3G02540)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019456603.1)
• Pfam: Ubiquitin-2 like Rad60 SUMO-like (PF11976.7)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;