Transcript | Ll_transcript_517546 |
---|---|
CDS coordinates | 294-1220 (+) |
Peptide sequence | MKVFVKTLKGTHFEIEVKPEDTVSEVKKNIENVQGADVYPAAQQMLIHQGKVLKDATTLEENKVAENSFIVIMLSKSKTSSGGGSATSTTPSVKTPQTSAAPTPLSPVSVAPQAPAATVAPQAPAATVAPLAPAATVAQPAPAPSPAPASIPSSTAVEGSDVYGQAASNLVAGTNLEEIIQEILAMGGGSWTRDTVVRALRAAYNNPERAVEYLYSGIPEQAEATVVAPVPASEQPANPTAAASQTTTQPAPVTSGGPNALPLDLFPQGLPNIGSGAASAGSLDFLRNSQQVFLIFSHPLIWTEFLIS* |
ORF Type | complete |
Blastp | Ubiquitin receptor RAD23c from Arabidopsis with 62.87% of identity |
---|---|
Blastx | Ubiquitin receptor RAD23c from Arabidopsis with 68.7% of identity |
Eggnog | ubiquitin(COG5272) |
Kegg | Link to kegg annotations (AT3G02540) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019452405.1) |
Pfam | Ubiquitin-2 like Rad60 SUMO-like (PF11976.7) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer