Transcript | Ll_transcript_517548 |
---|---|
CDS coordinates | 442-1659 (+) |
Peptide sequence | MKVFVKTLKGTHFEIEVKPEDTVSEVKKNIETVQGADVYPAAQQMLIHQGKVLKDDTTVEENKVAENSFIVIMLSKSKSPSGEGSTATAPSAKAPQTSAVLTPTSVSTAPQAHAVTGTTPLAVTAPTPAPALVPAPASAPVPAPTLSSTAVPGSDVYGQAASNLVAGSNLEETIQLIIDMGGGSWDRDTIVRALRAAYNNPERAVEYLYSGIPEQAEAPPVARVPGSVQPGNSPAAAPQAASVTSSGPNANPLDLFPQGLPNVGAGGAGAGGAGSLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPGEGGGDGGEGNILGQLAGAMPQSVTVTPEEQQAIERLEAMGFDRAIVLEVFFACNKNEELAANYLLDHIHEFDE* |
ORF Type | complete |
Blastp | Ubiquitin receptor RAD23c from Arabidopsis with 67.14% of identity |
---|---|
Blastx | Ubiquitin receptor RAD23c from Arabidopsis with 65.18% of identity |
Eggnog | ubiquitin(COG5272) |
Kegg | Link to kegg annotations (AT3G02540) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019456603.1) |
Pfam | Ubiquitin-2 like Rad60 SUMO-like (PF11976.7) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer